Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12741.1-v1.0-hybrid
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GRF
Protein Properties Length: 544aa    MW: 58521.7 Da    PI: 8.2798
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12741.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                      WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                              d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
                              79****************************************97 PP

                      QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                              +FT++Q+ +L++Q+++yKy++a++PvP +Ll++
  mrna12741.1-v1.0-hybrid  88 PFTNQQWKELERQAMIYKYMMASLPVPRDLLFP 120
                              8*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.3E-1087123IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-1388120IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.40388123IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.202148192IPR014977WRC domain
PfamPF088791.7E-20149191IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307906.10.0PREDICTED: growth-regulating factor 3
TrEMBLM5XKV00.0M5XKV0_PRUPE; Uncharacterized protein
STRINGVIT_16s0098g01080.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-33growth-regulating factor 7